PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Neem_28715_f_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
Family CPP
Protein Properties Length: 792aa    MW: 87579.8 Da    PI: 6.8893
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Neem_28715_f_1genomeNGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR475e-15514551239
             TCR   2 ekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNk 39 
                      +k+CnCk+skClk+YCeCfaag +C e C+C +C+Nk
  Neem_28715_f_1 514 ACKRCNCKRSKCLKLYCECFAAGLYCVEPCSCLGCFNK 551
                     689**********************************8 PP

2TCR51.32.4e-16599638140
             TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                     ++kkgCnCk+s+ClkkYCeCf+ g+ Cs +C+Ce+CkN+ 
  Neem_28715_f_1 599 RHKKGCNCKRSSCLKKYCECFQGGVGCSISCRCEGCKNSF 638
                     589***********************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011145.7E-17513554IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163435.895514639IPR005172CRC domain
PfamPF036384.3E-11516551IPR005172CRC domain
SMARTSM011141.5E-17599640IPR033467Tesmin/TSO1-like CXC domain
PfamPF036386.6E-12601637IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 792 aa     Download sequence    Send to blast
MDTPDKNRIA VSSLSKFEDS PVFNYISSLS PIEQIKSINT DNSFNSVTFT SPSSLFATPK  60
INSLRESRFL LSSNQSPDIL KPELHGKENK TSKGNSEAVQ LSEHCTEKLG FLTPGSSARE  120
VVSKLLDENL ELTIELPKTM KYDGRTPVSE GMSCDVKEAS RGQEMAGASS SLVQSDKGNV  180
ADADHFEDKS NLRKICRIEQ SQEVEGSDWV SLLSDAVLNS DLSIIENNPE DEDQKTVGTG  240
EISFISTVLQ LPQDNANDLT DMVSVSPSCS CKQSDMIEPV TQPEEIRYLK DMDQTPDILS  300
SNLLNKLVVS DPRAKKDNEE EKCEQSNCKQ NNIRRRCLVF EMAGVHKKQA ACETNCRPLI  360
PSKTDCKDAY AEKHLLPSKT KSCSSSMVAG VGLHLNALAT TSKNSKVVKC ETLASGRKLI  420
SMRSSLSSSL SLTSCQSLLN KSSTVKSEER DPVPAGNEVK VVENAVQPSV IAACEEFDHS  480
SPKRKRHKFF SLWFKVNSLI IFRCKPEHNG ESKACKRCNC KRSKCLKLYC ECFAAGLYCV  540
EPCSCLGCFN KPIYEDKVLE TRRQIEFRNP LAFAPKVIRG TDSAVEIGDE TNKTPASARH  600
KKGCNCKRSS CLKKYCECFQ GGVGCSISCR CEGCKNSFGR KDGAEESEYE GEEAEACEKN  660
ELDANISDNV VKEGEEEHPD LLLPSSDIPR AKRSGSSLLL VNPPPKLCIS LQTSQFNQPN  720
FEEHFLQSTP ENETTKILKN SFSQSSMIPA SPNSKRVSSP YHEIGSSTRY RSRRFLLRSS  780
LSFPSVTPPR EQ
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006471928.10.0PREDICTED: CRC domain-containing protein TSO1 isoform X3
TrEMBLA0A067DFH00.0A0A067DFH0_CITSI; Uncharacterized protein
STRINGVIT_14s0030g01800.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM17096510
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G04850.13e-85Tesmin/TSO1-like CXC domain-containing protein